<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10472

Description LAFE_0G12794g1_1
SequenceMYSAQNKAANLYQQPQQPQQRNFMVQSQQSNAHGVWQQQQIADSKGNGNGGGKPLLMANNNVFSIGPYKKRKDATRISVVEKYEIIGYIAAGTYGKVYKAKRKDIATSTSGSLDIESNATVMSTDIASNTEQPLDVNSINRSTRAQEPGSTAPKVRNESYDQPQKKATTSTELPITASDQLLPNRSKPLSGSSMISLPINKPTPYYAIKKFKTEREGVEQLHYTGISQSACREMSLCRELNNKHLTQLVEIFLEKKSIYMVSEFAEHDLLQIIHFHSHPEKRLIPPKMLKSIIWQILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFHNMVQTLYTGDKVVVTIWYRAPELLLGARHYTPAIDLWAVGCIFAELIGLRPIFKGEEAKMDSKKSVPFQANQLQRILEILGNPTEKTWPNIYKYPEYEQLAKFPRYRDNLPVWYHSAGGRDKNALDLLYQLLRYDPVTRIDAINALDHPYFVNGDPTVCENVFEGLNYKYPPRRIHTNDNDIMNMNGYKNKNVAIHQQQAVGTNNASNAALGGLGVNRRILAAAAAAAAAVSGNNSSIQGSTSTNISGPSRKKRR
Length593
PositionKinase
OrganismLachancea fermentati (Zygosaccharomyces fermentati)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea.
Aromaticity0.08
Grand average of hydropathy-0.512
Instability index45.10
Isoelectric point9.45
Molecular weight66416.82
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10472
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     115.32|      25|      73|     409|     433|       1
---------------------------------------------------------------------------
  409-  433 (44.47/27.90)	NQLQRILEILGNPT..EKTWPNI.YKYP
  446-  468 (33.14/18.96)	DNLPVWYHSAGGRD..KNALDLL.YQ..
  482-  509 (37.72/22.57)	NALDHPYFVNGDPTvcENVFEGLnYKYP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.06|      11|      29|      68|      78|       2
---------------------------------------------------------------------------
   68-   78 (21.50/17.20)	YK.KRKD.ATRIS
   98-  110 (12.56/ 6.82)	YKaKRKDiATSTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.41|      14|      23|       3|      16|       4
---------------------------------------------------------------------------
    3-   16 (25.10/17.02)	SAQNKAANLYQQPQ
   27-   40 (27.32/19.20)	SQQSNAHGVWQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     100.05|      32|      53|     123|     158|       6
---------------------------------------------------------------------------
  123-  158 (49.40/37.60)	STDIASNTEQPLDVNS.....INRSTraqePGSTAPKVRNE
  178-  214 (50.66/29.60)	SDQLLPNRSKPLSGSSmislpINKPT....PYYAIKKFKTE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.55|      20|      29|     318|     337|       8
---------------------------------------------------------------------------
  318-  337 (34.05/22.94)	IMVTVDGCVKIGDLGL.ARKF
  350-  368 (25.13/15.15)	VVVTI..WYRAPELLLgARHY
  372-  391 (33.37/22.35)	IDLWAVGCIFAELIGL.RPIF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10472 with CDK8 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ESNATVMSTDIASNTEQPLDVNSINRSTRAQEPGSTAPKVRNESYDQPQKKATTSTELPITASDQLLPN
116
184










Molecular Recognition Features






MoRF SequenceStartStop




NANANA