<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10469
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MKQSAVIFIEKATPASITEFHDILSNDLLSIKEKWSFEFKTFRFAVKNLPPQDPKLMHSITFTHRGNQTVIIKNKSAVVTSSPAADPPQQLTFNSCSTGAPESFDTILTTKLSNLWTQRQSIKGDFGSTFLTTDLIIRATNVFSYGGFKGLLIELECNDGASISDFEKRIERVRSHLYGISLREIKICRDVMDTTKPNFLCDLAYQYIKVLEI |
Length | 213 |
Position | Head |
Organism | Lachancea fermentati (Zygosaccharomyces fermentati) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.153 |
Instability index | 42.35 |
Isoelectric point | 8.30 |
Molecular weight | 24052.34 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR007945
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10469
No repeats found
No repeats found
|