Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MVTLNNPHLAQIHSTLVPDPNSEHQTLEFIPQLYYSLYQLKKEPNNSSISLENTTSSIRHRLKQCKSYIEESEECRTLLGQTCTEWEHAIEQRERELEVKKQVLTTLSEQIKQLKGT |
Length | 117 |
Position | Middle |
Organism | Lachancea fermentati (Zygosaccharomyces fermentati) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.786 |
Instability index | 48.06 |
Isoelectric point | 5.94 |
Molecular weight | 13652.24 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10456 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.58| 22| 22| 7| 28| 1 --------------------------------------------------------------------------- 7- 28 (39.45/25.27) PHLAQIHSTLVPDPNSEHQTLE 31- 52 (38.13/24.22) PQLYYSLYQLKKEPNNSSISLE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 86.20| 26| 26| 54| 79| 2 --------------------------------------------------------------------------- 54- 79 (43.19/24.75) TTSSIRHRLKQCKSYIEESEECRTLL 82- 107 (43.02/24.63) TCTEWEHAIEQRERELEVKKQVLTTL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EHQTLEFIPQLYYSLYQLKKEPNNSSI 2) IRHRLKQCKSYIEESEECRTLL | 23 58 | 49 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab