Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTTMEDHISPAYYYYVDPATVYQPQQPSPVDDLISLYGLQDLSRQVARTNPDGTKAVKLRKSYKNQINDLSGKFSVIPTRENGKGGEISQTLFQNNPDMMPQVHRTPDMSSEQWRHLMMDRDAALFNGDNMDWNMCESVLTQFEKSYPAEFQSQGFQVDDLAFDLDGSGNAIKSRKRKNKSNGSSMATPNSDMQEDLKRRRLE |
Length | 203 |
Position | Head |
Organism | Lachancea fermentati (Zygosaccharomyces fermentati) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.913 |
Instability index | 50.28 |
Isoelectric point | 5.45 |
Molecular weight | 23174.57 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10455 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.95| 12| 54| 41| 52| 2 --------------------------------------------------------------------------- 41- 52 (22.29/13.09) DLSRQVARTNPD 87- 98 (20.66/11.71) EISQTLFQNNPD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AYYYYVDPATVYQP 2) DLISLY 3) IKSRKRKNK 4) MQEDLKRRRLE | 11 32 172 193 | 24 37 180 203 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab