<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10455
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTTMEDHISPAYYYYVDPATVYQPQQPSPVDDLISLYGLQDLSRQVARTNPDGTKAVKLRKSYKNQINDLSGKFSVIPTRENGKGGEISQTLFQNNPDMMPQVHRTPDMSSEQWRHLMMDRDAALFNGDNMDWNMCESVLTQFEKSYPAEFQSQGFQVDDLAFDLDGSGNAIKSRKRKNKSNGSSMATPNSDMQEDLKRRRLE |
| Length | 203 |
| Position | Head |
| Organism | Lachancea fermentati (Zygosaccharomyces fermentati) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.913 |
| Instability index | 50.28 |
| Isoelectric point | 5.45 |
| Molecular weight | 23174.57 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10455
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.95| 12| 54| 41| 52| 2
---------------------------------------------------------------------------
41- 52 (22.29/13.09) DLSRQVARTNPD
87- 98 (20.66/11.71) EISQTLFQNNPD
---------------------------------------------------------------------------
|