Description | LAFE_0B10550g1_1 |
Sequence | MTDRLTQLQICLDQMMEQFCATINYIDKNHDFEPSSSGEEKMTDPQATIATSEEFTNTIDELSTDLILKTRQIIKLIDSLPGVDVSAEEQMHRIDALQKKLMKVEDEKLQAIKEKEELLKSVNSMICDFTQGIANSRKPVEMPESSA |
Length | 147 |
Position | Middle |
Organism | Lachancea fermentati (Zygosaccharomyces fermentati) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.492 |
Instability index | 47.55 |
Isoelectric point | 4.55 |
Molecular weight | 16684.82 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP10454 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) PVEMPE 2) QATIA | 139 46 | 144 50 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab