<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10449
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSAPQLDELQWKSPEWIQSFGLRTDNVLDYFAESPFFDRTSNNQVAKMQQQFVQPRTAERGGPALDIQDPDPHRRFILSTYMVHALWETELRKLKGVEYILAYVREPDFWIIRKQNRTGPNEVSALQEYFIIGANVYQSPTVFKIIQSRLLASNLHLSKALSSLRRMSHFQPSQGGGFVKTAYQNVPSLSQQSTTIASTASGTNSAANTGPATANGQSSLTGSVDPINSIGSHTNTINEALMDKLLATSMKSSPVYL |
Length | 257 |
Position | Head |
Organism | Lachancea nothofagi CBS 11611 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.384 |
Instability index | 53.49 |
Isoelectric point | 8.78 |
Molecular weight | 28572.83 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10449
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.18| 15| 22| 163| 184| 2
---------------------------------------------------------------------------
163- 177 (28.32/25.98) SLRRMSHFQPSQGGG
188- 202 (23.86/ 7.08) SLSQQSTTIASTASG
---------------------------------------------------------------------------
|