| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MVALDLNKMHDDLAGVEQQIGAIIESFVELGVSVYDFPGTSEAAQGMMTNLKRNVDRLGKLNKQSNDPDSQLNLFQIPIEVLQYIEDGRNPDVYTRDFVEAIRRSNQYQRAKMNGVKQLRDKLAHKIVEEFPDMEASVKDILNRTER |
| Length | 147 |
| Position | Middle |
| Organism | Lachancea dasiensis CBS 10888 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.567 |
| Instability index | 54.58 |
| Isoelectric point | 5.08 |
| Molecular weight | 16796.83 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats |
>MDP10429
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.97| 32| 58| 6| 37| 1
---------------------------------------------------------------------------
6- 35 (45.13/30.42) .........................LNKM...........HDDLAGVEQ..QIG.......AIIESFVELGVS..VY
36- 94 (30.59/18.63) DFpgtseaaqgmmtnlkrnvdrlgkLNKQ...........SNDPDSQLNlfQIP.......IEVLQYIEDGRNpdVY
97- 139 (25.25/14.30) DF...........................veairrsnqyqRAKMNGVKQ.....lrdklahKIVEEFPDMEAS..VK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) LKRNVDRLGKL 2) PDVYTRDFV 3) QLNLFQIPIEVLQYIE | 51 91 71 | 61 99 86 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab