| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTTMDDHYSPAYYYYVDPASLYQPQQPNPLDDLISVYGLQNISQQVARTNPDGTKAVKLRKSYKNQINDLSGKFSVIPTRENGKGGDIAPILFQNNPDMVPQVHKTADMTPEQWHQLMCDRDAGLFQPQNMDWDVCQAVLSQFERSHPAEFQANGFQADDLAFDLDGSGNTLKPRKRKNKSSGSSMATPNSDLQEDMKRRRLE |
| Length | 203 |
| Position | Head |
| Organism | Lachancea dasiensis CBS 10888 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.877 |
| Instability index | 47.72 |
| Isoelectric point | 5.57 |
| Molecular weight | 22989.35 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi transcription open complex formation at RNA polymerase II promoter GO:0001113 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats | >MDP10426 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) LQEDMKRRRL 2) PAYYYYVDPASLYQPQ 3) TLKPRKRKNK | 193 10 171 | 202 25 180 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab