<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10422
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MPQPEFIQERLKSLDSIDRMLLSTLLHASQSVGTLEELKRGNENMKPQFENHARNFYSSLEKATVALRREIKHLDDNVGTRLLPINVNKKATGQDNDKIREQLDILTKEIEGGD |
| Length | 114 |
| Position | Head |
| Organism | Lachancea dasiensis CBS 10888 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.769 |
| Instability index | 52.26 |
| Isoelectric point | 5.93 |
| Molecular weight | 13041.62 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10422
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 107.05| 33| 43| 2| 34| 1
---------------------------------------------------------------------------
2- 34 (55.18/36.63) PQPE.FIQERLKSLDSIDRMLLSTLLHASQSVGT
47- 80 (51.87/34.11) PQFEnHARNFYSSLEKATVALRREIKHLDDNVGT
---------------------------------------------------------------------------
|