<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10418
| Description |
LADA_0G04390g1_1 |
| Sequence | MDDSSNNNDVNEARPLENLFERLGSDHEFKNSIKQELQNVQNSILPMRLHFNELLNAMASIDAKQESSALERFTYVRTKLLEFMKDVDTLSSDYVRLQPLFDGLQQASKDDNISVKFSPLERLSNINDAALATAGRPQSGKRSNVNSPSALAAASTTKSAVSSGNTPSSNLPTPSTTASAAAKKPRKPRTKKNSGPSPSSMPSQPQPPSQALQQAIHQQQPAQSMQHQKQFTPSTNPSQLLSGMSPMNIMSSPLNTMSPVNGSNMSFPPGGKPSNMHSVQRHVQPSQPSFNSNSITPANILSMSMSDQSNPAAAYTQMNPQGSVNQDLGSLDLNNIDLSNLNMDFLQ |
| Length | 347 |
| Position | Tail |
| Organism | Lachancea dasiensis CBS 10888 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.700 |
| Instability index | 71.53 |
| Isoelectric point | 7.95 |
| Molecular weight | 37595.42 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10418
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.50| 18| 22| 75| 96| 3
---------------------------------------------------------------------------
53- 72 (23.85/15.64) ELLNAMASIDAkqESSALER
79- 96 (30.65/14.28) KLLEFMKDVDT..LSSDYVR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.65| 24| 49| 228| 251| 5
---------------------------------------------------------------------------
222- 246 (38.01/17.31) AQSMQ...........................hQKQFTPSTNPSQLLSGMSP
247- 297 (26.26/ 9.73) MNIMSsplntmspvngsnmsfppggkpsnmhsvQRHVQPS.QPSFNSNSITP
298- 320 (28.39/11.11) ANILS.........................msmSDQ....SNPAAAYTQMNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.60| 11| 17| 124| 134| 6
---------------------------------------------------------------------------
124- 134 (19.27/11.86) SNIND.AALATA
143- 154 (14.33/ 7.12) SNVNSpSALAAA
---------------------------------------------------------------------------
|