<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10418

Description LADA_0G04390g1_1
SequenceMDDSSNNNDVNEARPLENLFERLGSDHEFKNSIKQELQNVQNSILPMRLHFNELLNAMASIDAKQESSALERFTYVRTKLLEFMKDVDTLSSDYVRLQPLFDGLQQASKDDNISVKFSPLERLSNINDAALATAGRPQSGKRSNVNSPSALAAASTTKSAVSSGNTPSSNLPTPSTTASAAAKKPRKPRTKKNSGPSPSSMPSQPQPPSQALQQAIHQQQPAQSMQHQKQFTPSTNPSQLLSGMSPMNIMSSPLNTMSPVNGSNMSFPPGGKPSNMHSVQRHVQPSQPSFNSNSITPANILSMSMSDQSNPAAAYTQMNPQGSVNQDLGSLDLNNIDLSNLNMDFLQ
Length347
PositionTail
OrganismLachancea dasiensis CBS 10888
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea.
Aromaticity0.04
Grand average of hydropathy-0.700
Instability index71.53
Isoelectric point7.95
Molecular weight37595.42
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10418
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.50|      18|      22|      75|      96|       3
---------------------------------------------------------------------------
   53-   72 (23.85/15.64)	ELLNAMASIDAkqESSALER
   79-   96 (30.65/14.28)	KLLEFMKDVDT..LSSDYVR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.65|      24|      49|     228|     251|       5
---------------------------------------------------------------------------
  222-  246 (38.01/17.31)	AQSMQ...........................hQKQFTPSTNPSQLLSGMSP
  247-  297 (26.26/ 9.73)	MNIMSsplntmspvngsnmsfppggkpsnmhsvQRHVQPS.QPSFNSNSITP
  298-  320 (28.39/11.11)	ANILS.........................msmSDQ....SNPAAAYTQMNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.60|      11|      17|     124|     134|       6
---------------------------------------------------------------------------
  124-  134 (19.27/11.86)	SNIND.AALATA
  143-  154 (14.33/ 7.12)	SNVNSpSALAAA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10418 with Med3 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) INDAALATAGRPQSGKRSNVNSPSALAAASTTKSAVSSGNTPSSNLPTPSTTASAAAKKPRKPRTKKNSGPSPSSMPSQPQPPSQALQQAIHQQQPAQSMQHQKQFTPSTNPSQLLSGMSPMNIMSSPLNTMSPVNGSNMSFPPGGKPSNMHSVQRHVQPSQPSFNSNSITPANILSMSMSDQSNPAAAYTQMNPQGSVNQDLGSLDL
126
333










Molecular Recognition Features






MoRF SequenceStartStop




NANANA