<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10417
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSKNASNEITALYPPPPPYIEHFTAENLHKLQELEKAGRGAESLDDGLKYLVPPDVPTEGHYRAFGSVWQVKDELPDLKSMGMTQLYLPKADTDGSKSSYQDKIQELHKLLQSLLLNFLELTGILSVNPEQFPAKVDHIQTILVNFHHLLNEYRPHQSRESLIMLLEEQLEYKRKEISKIEQVCQEVKEKLANLIDGGDKYEDSTLSQSKRPDAGDVEMADAVDVTEEHPTDGAQEDGNHA |
| Length | 241 |
| Position | Middle |
| Organism | Lachancea dasiensis CBS 10888 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.669 |
| Instability index | 49.17 |
| Isoelectric point | 4.85 |
| Molecular weight | 27217.18 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP10417
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.28| 11| 26| 111| 121| 1
---------------------------------------------------------------------------
111- 121 (17.99/11.45) LQSLLLNFLEL
139- 149 (20.28/13.66) IQTILVNFHHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.75| 9| 34| 50| 60| 3
---------------------------------------------------------------------------
50- 60 (13.78/15.69) YLvpPDVPTEG
87- 95 (17.97/10.96) YL..PKADTDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.10| 21| 26| 159| 179| 4
---------------------------------------------------------------------------
159- 179 (32.61/23.44) RESLIMLLEEQLEYKRKEISK
188- 208 (33.48/24.26) KEKLANLIDGGDKYEDSTLSQ
---------------------------------------------------------------------------
|