<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10407
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSAAGTLKSSGIDRPGSIENPLLRTRIYNDICEYEDTLGRLVASVDKFQPDMQIARDLMKVDQKLSETVKALREYDAIDGRAKKLEAEHRETDAKTAKVLEVLTECHDELNTLPMLEQVEFERATMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRAAEEVQSATEAKGDEEKKPEPAEESQIGENREELSRRASYEFNGGTRAQESEEKPDEDIDLDLDLLGEEF |
Length | 254 |
Position | Middle |
Organism | Lachancea dasiensis CBS 10888 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.692 |
Instability index | 39.98 |
Isoelectric point | 4.69 |
Molecular weight | 28669.84 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP10407
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.14| 23| 36| 182| 204| 1
---------------------------------------------------------------------------
182- 204 (38.07/22.33) SLRAAEEVQSATEAKGDEEKKPE
219- 241 (41.07/24.58) SRRASYEFNGGTRAQESEEKPDE
---------------------------------------------------------------------------
|