<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10401
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSTPQLDELQWKSPEWIQSFGLRTDNVLDYFAESPFFDRTSNNQVAKMQQQFAQPRPAGPGGPALEVQDPDPHRRFILANYVVHALWETELRKLKGVEYVLAYVREPDFWIIRKQNRSSPSETTPLQEYFIIGANVYQSPTLLKIIQSRLLSSNLHLSKALANLRRMSNFQPSQGGRFVKTAYQAVASNSQQTTAVQSTTSGSNSAANTGPTTVNGQSVLTGSVDPINSAGSHSSTMDEALMDKLLATSMKSTTVYL |
| Length | 257 |
| Position | Head |
| Organism | Lachancea dasiensis CBS 10888 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.430 |
| Instability index | 54.37 |
| Isoelectric point | 8.78 |
| Molecular weight | 28503.68 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP10401
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.73| 13| 17| 108| 120| 1
---------------------------------------------------------------------------
108- 120 (24.91/20.46) DFWIIRKQNRSSP
128- 140 (23.82/19.25) EYFIIGANVYQSP
---------------------------------------------------------------------------
|