| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MATNDLISPAYYYYVDPGAVYQPQQPNPLEDLISVYGLQDVSRQVARTNADGSKAVKLRKSYKNQISDLSGKFSAIPTRENGKAGDISHILFQNNPDMMAQVTRTAGMSDDQWRQLMMDRDSAIFNDPNNINWNACQAVLSQFDRSYPGEFQSHGFQVEDLAFDLDGSGNAIKNRKRKAKSGGSSMATPNSDIQDDMKRRRLE |
| Length | 203 |
| Position | Head |
| Organism | Lachancea mirantina |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.772 |
| Instability index | 45.32 |
| Isoelectric point | 6.14 |
| Molecular weight | 22738.01 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP10398
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.82| 35| 94| 68| 104| 1
---------------------------------------------------------------------------
68- 104 (57.25/43.19) DLSGKFSAIPTRE.NGKAGDIShiLFQNNPDMMAQVTR
164- 199 (56.57/35.99) DLDGSGNAIKNRKrKAKSGGSS..MATPNSDIQDDMKR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DLISPAYYYYVDPGAVYQP 2) IKNRKRK 3) IQDDMKRRRL | 5 172 193 | 23 178 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab