<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10387
Description |
Mediator of RNA polymerase II transcription subunit 1 |
Sequence | MSDLYVETLSDMIALLQEYKPGLVTLENVTRLCKTLRLESFTDNIDSETIRLSAASNIIVIDMDFHKADERVKDVKLVLASNFDNFNYFNDEDNSNILYNSLSCYPDLHTFYFNLKFLSILDTYSNIETEPRISGQHDKLDLFKYFTELPDQLRTFFKDMSMVEEIRTNVDNKFGIYVMRAGTLVAKIDIEECDAHGERFHDYRYQNSSWTADASHKNAMGVMLVLKIFDTSLHFPQELISRDLVLDSDSHKPYSVANHQKSLHLFNDITSNLIPASKFKISNDNIELLGELLRWVSWWQHVLSPVLQTLKCPAPHPPNDPKRRTSSNSTSAPAQRRLNHTTRRRRSSQKGRRPSLTDSSMMKDGGLQQFTLTEVMSQPVVEEDEPSDIIDLVLNEEYLALGTHHRCHIEGGLQEWQAFVGSFKSIAL |
Length | 428 |
Position | Middle |
Organism | Lachancea dasiensis CBS 10888 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.415 |
Instability index | 58.41 |
Isoelectric point | 5.52 |
Molecular weight | 49209.01 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP10387
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.61| 15| 42| 98| 112| 1
---------------------------------------------------------------------------
98- 112 (30.48/21.31) LYNSLSCYPD.LHTFY
142- 157 (24.13/15.33) LFKYFTELPDqLRTFF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.65| 15| 19| 313| 327| 2
---------------------------------------------------------------------------
313- 327 (30.16/21.47) PAPHPPNDPKRRTSS
333- 347 (27.49/18.94) PAQRRLNHTTRRRRS
---------------------------------------------------------------------------
|