Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MAAGSMENSHLAQIEALLAPNSAQESPTVEFIPQLSYALHQVKKDPNSSTNSLEAATSSIRHRLKQCKAHLAENAACRELLSQTPAEWSKVLEQRQRNLDAKRQVFQQLEEQVQRL |
Length | 116 |
Position | Middle |
Organism | Lachancea dasiensis CBS 10888 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.634 |
Instability index | 48.47 |
Isoelectric point | 6.90 |
Molecular weight | 13019.51 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi cytosol GO:0005829 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | structural molecule activity GO:0005198 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP10385 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 76.05| 22| 50| 2| 23| 1 --------------------------------------------------------------------------- 2- 23 (37.65/22.89) AAGSMENSHLAQIEALLAPNSA 55- 76 (38.40/23.46) AATSSIRHRLKQCKAHLAENAA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HLAQIEALLAPNSAQESPTVEFIPQLSYALHQVKKDPNSSTNSLEAATSSIRHRLKQCKAHLA 2) QTPAEWSKVLE | 10 83 | 72 93 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab