<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10363
| Description |
Uncharacterized protein (Fragment) |
| Sequence | KVTSYRGTPTAPPTDSKTLSRLTAGALTSEFTSPQRRHPPTSLSLSLSLSHLNTTQPSTMDTSRDSSNLLDTHNRLIADVLSRFRMLTMLATIQAEGERKNAEPQTVAVTGMSMQMEFEGLHTSIKDLLALSRRLKELWLFGKLGQGEGDARIQADKLQADVVRCAELLNAIQETRFSGLAAAAEGKWVPMGRADAVSVEGGGAAAAAPPPAAPTASNGAGGAA |
| Length | 224 |
| Position | Head |
| Organism | Colletotrichum orchidophilum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.263 |
| Instability index | 31.77 |
| Isoelectric point | 8.11 |
| Molecular weight | 23610.44 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10363
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.33| 17| 22| 182| 203| 1
---------------------------------------------------------------------------
182- 203 (24.98/23.97) AAAegkwvPMGRADAVSVEGGG
206- 222 (32.35/17.21) AAA.....PPPAAPTASNGAGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.21| 17| 24| 3| 22| 2
---------------------------------------------------------------------------
3- 20 (28.24/18.25) TSYRGTP..TAPPTdSKTLS
28- 46 (27.98/ 8.95) TSEFTSPqrRHPPT.SLSLS
---------------------------------------------------------------------------
|