<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10352
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRASSASFRLGPPSPSSPAAGSLKANHPSYTSTEHTPQTPTSPPLMSVSAQNYASNFASSQTSPGQATSQPANLSSPPSSVPMSTQASQQPTVGTTNSFPTPASSVNGHFTGATPVDDSEQTEKSFGPEMGATSTTDMNAPMQQTEYRRTDHDRQSEGPSAQTGIRDFGNTGGQDMLNHGDAMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATGPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHEPGMAGGLRQMTMWPEEEWQNQKVFGKEIKVADMDSALYNLQMRAMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKTATPSNGARVPSHANGTPTATEPERARPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGISKKKRKKV |
Length | 431 |
Position | Head |
Organism | Aspergillus bombycis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.919 |
Instability index | 48.74 |
Isoelectric point | 6.20 |
Molecular weight | 46239.14 |
Publications | PubMed=27664179
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10352
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.83| 18| 20| 106| 125| 1
---------------------------------------------------------------------------
106- 125 (28.98/19.37) SSvnGHFTGATPVDD....SEQTE
127- 148 (28.85/13.59) SF..GPEMGATSTTDmnapMQQTE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 105.24| 20| 20| 54| 73| 2
---------------------------------------------------------------------------
28- 46 (35.94/18.87) NHPS.YTSTEHTPQTPTSPP
54- 73 (36.15/19.02) NYASNFASSQTSPGQATSQP
75- 93 (33.15/16.79) NLSSPPSSVPMST.QASQQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 284.11| 83| 137| 184| 267| 3
---------------------------------------------------------------------------
184- 267 (135.91/82.31) AMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATgPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKG
324- 406 (148.21/85.89) AMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKTAT.PSNGARVPSHANGTPTATEPERARPSRGRKRHYDDNSFVGYGEG
---------------------------------------------------------------------------
|