<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10342
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLVTYHDNSPTIPPQNDPTAAPALAKITKNSSAPPVPAGAPAASQASPQQQAAQIPGQQQQGGGDAGQTPGAGGMAADPNLPPAPDSPRTFASRQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERKIRELEKELRSAEEDREQRVRELRKLRKKLENVLGAIEVGIYGDRGIVASRR |
| Length | 204 |
| Position | Middle |
| Organism | Aspergillus bombycis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.606 |
| Instability index | 64.75 |
| Isoelectric point | 5.35 |
| Molecular weight | 22030.45 |
| Publications | PubMed=27664179
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10342
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.33| 20| 32| 107| 126| 1
---------------------------------------------------------------------------
107- 126 (35.94/19.31) PAPDSPRTFASRQ.RELARDL
141- 161 (29.39/14.71) PGIDSSEAEQERKiRELEKEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.78| 29| 32| 38| 67| 2
---------------------------------------------------------------------------
38- 67 (46.89/29.29) PQNDPTAAPALAKiTKNSSAPPVP.AGAPAA
72- 101 (48.89/26.51) PQQQAAQIPGQQQ.QGGGDAGQTPgAGGMAA
---------------------------------------------------------------------------
|