<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10337
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPVTLKTVDDDLKDVIQQLFEIQSAVHGYLGPETQQELVRKIKNLTLALSTLSTHTQLPPNTEIQPDQTTDPSNPPLSSIQLPPEIIDYVDSARNPDIYTREFVELVQRGNQDLRGKREAFASFRDVLAREMRSAMPECRGEVDRVVVASGGKVPDSDGGH |
| Length | 162 |
| Position | Middle |
| Organism | Penicillium arizonense |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.515 |
| Instability index | 38.93 |
| Isoelectric point | 4.84 |
| Molecular weight | 17978.98 |
| Publications | PubMed=27739446
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10337
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 68.79| 15| 15| 55| 69| 1
---------------------------------------------------------------------------
28- 41 (18.11/ 7.80) .HGYLGPETQQE.LVR
55- 69 (28.45/15.74) THTQLPPNTEIQ.PDQ
71- 86 (22.23/10.97) TDPSNPPLSSIQlPPE
---------------------------------------------------------------------------
|