<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10319
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRTQPASFQARPPSPSSPAAGSLKENHRLPISSDHIPQTPTSPPLMSVSDQNDAANFTSSHTSPNQATVHPPNVSSPPSSTPMSTQASQQQPMSSTNSFPTPASSVNGYPLNATGEDKDGRKYFNVNTNDSTENSGPDQSSEHRRTDHNRQTFSTDTNTIGRGQQHSDPDAMEVDTEPARRSDISNLGLDSLQKELTSAFHLCKSSPIVTGPDPSVDLVSLYGLGPIAHSVARLDPVTGEKINRLRKSYEGKLKGLGLAGRNKPFKQEPGAPGSLRHMTLWPEEEWQNQKVFGKQIKISDMDTALQDLQSRAMQMEPGPVPNNDFWEDILGHEKPVKNPASNEHSKKAASTPSNRPSMHSNAASPQPQPQEVDRPRPSRGRKRHYDDNSFAGYGEGFVDDEEDPGFYSNGEGTGKKKRKKDHVAKVSTPMSSGAVLAFTVGSITVALSHASHQMLIGRSIQGIGGGGIMALTELLLADLIPRQERGKWFSIRPGTWAPETVVGPIIDGGSAQSSASWR |
| Length | 520 |
| Position | Head |
| Organism | Penicillium arizonense |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.829 |
| Instability index | 53.62 |
| Isoelectric point | 6.64 |
| Molecular weight | 56195.39 |
| Publications | PubMed=27739446
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transmembrane transporter activity GO:0022857 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10319
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 534.71| 171| 215| 102| 285| 1
---------------------------------------------------------------------------
102- 285 (255.43/160.85) PTPASSvNGYPLNATGEDKDGRkyfNVNTNDSTEN..SGP.DQSSEHRRTDHNR.QTFSTDTNTIGRG.QQHSDPDAME......VDTEpARRSDISNlGLDSLQKELTSAfHLCK.SSPIVTGpdpSVdLVSLYGLGPIAHSVARLDPVTGEKINRLRKSYEGKLKGLGLAGRnKPfKQEPGAPGSLRHMTLWPE
319- 501 (279.28/137.35) PGPVPN.NDFWEDILGHEKPVK...NPASNEHSKKaaSTPsNRPSMHSNAASPQpQPQEVDRPRPSRGrKRHYDDNSFAgygegfVDDE.EDPGFYSN.GEGTGKKKRKKD.HVAKvSTPMSSG...AV.LAFTVGSITVALSHASHQMLIGRSIQGIGGGGIMALTELLLADL.IP.RQERGKWFSIRPGTWAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.71| 24| 24| 14| 37| 2
---------------------------------------------------------------------------
11- 35 (37.45/13.92) QA........rPPSPSSPAAG...SLKE.NHRLPISS
36- 61 (32.52/11.21) DH........iPQTPTSPPLM...SVSDqNDAANFTS
62- 97 (30.74/10.24) SHtspnqatvhPPNVSSPPSStpmSTQA.SQQQPMSS
---------------------------------------------------------------------------
|