<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10317

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMATVEKAVSTETQPEIPHVEVNQIQLSVVIRNLCIYTMTEIKEFFKLEQPNQRQNMLKLVVYLRNQFLRLYVLVKWVKTIKNNNFHLLIDLLNYLRVKNMNVGQVIWNLKNIVINSTINAKLPKPDLETSLEVFTLGIPQLEQDVDVVKKLNIIKHTYGQKQNLIPNHLIIQKLEDLDVYLSVKVALADVPQSFRXGTKTIKDGKWVVEIEGEYEIILSVTNDSSPFHLVDIRFLLSSPSLDLSKHQTNKILYQQLNTILSADKSKCLYEVEELLSRKILFLRIFLCKQILVNYNQSKGQFESPLKIVYDESSITINYWASSKLVSPKQDHSIVVNIKEDFEADNKLKLAMKWNLXIPDNIKSHLNIKTEYFEDLFENIVDYITEIINNHIKLIKHTLFINGKXVFNGSEHNLTFEVPITPTKTSVLEIDVDRKTGKYQFFDTDHCLNSNNLLIAQTNSINQQHLHTNEVLSXIQSFKIKNSLIVLQNMFLKTGWCVFNDSQIMITXLDSTLKAKRSFIRMKSWPLHWYLIVSTRINSTNDIIVYVQIAKLIRENVHWQIKHLSEFLMFDNAVQVNHISMKDITYKXIFKLQNSILTKIISHSILDIFTQLKLDAKQISTSTSGLKFLPHYIHDNLKEQNIDIGSLSIFCIKAEDFMTDNKHSNIIKPVLFLVIDSSNDIRLYGSFDDSFETSSLTSCNPEDLHINFLGQKAFYMKTDEKALSDITPTENDDESSTSLMAMKHVISKYKNDLQHLIVLTSTITRLTAIFSSKNFXIIKVNVNEILFNYLPKYQKNSDSLEYDCRIXLENIDSLTELKFELSHNNPQRVLDKFLDFTGKXPINQKVLFEYYQNTSQLFSVIEQIKHFYKENGPKTNNNDFKLYVHSLTEFELGFYTINDDESYEGISIKLDLRVINRGHDVPALLYEIKTRIIDVNKNIKKSSDTSSKNSKFELINERIHKECFAANKNDQNNKFGIIEKNSKLLLQLEKYILCTPDDVYDVVSYIHNIIQN
Length1011
PositionTail
OrganismHanseniaspora uvarum (Yeast) (Kloeckera apiculata)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycodaceae> Hanseniaspora.
Aromaticity0.09
Grand average of hydropathy-0.225
Instability index34.13
Isoelectric point6.90
Molecular weight116351.57
Publications
PubMed=27856586

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10317
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.99|      14|      21|     290|     304|       1
---------------------------------------------------------------------------
  290-  304 (21.84/18.84)	ILVNYNQSkGQFESP
  314-  327 (26.16/17.26)	ITINYWAS.SKLVSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     199.27|      48|     500|     142|     194|       2
---------------------------------------------------------------------------
   29-   85 (56.28/25.47)	VIRNLCIytmteIKEFFkleqpNQRQNML..KLVVYlRNQFLRLYVLVKWVKTIKNNNF
   97-  141 (64.99/33.64)	.VKNMNV.....GQVIW.....NLK.NIVINSTINA.KLPKPDLETSLEVFTLGIPQ.L
  147-  194 (77.99/49.07)	VVKKLNI.....IKHTY.....GQKQNLIPNHLIIQ.KLEDLDVYLSVKVALADVPQSF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.86|      32|     159|     625|     697|       3
---------------------------------------------------------------------------
  357-  400 (44.08/ 8.07)	IPDNIK.........SHLNIKTEyfedlfenivDYITEiiNNHIKLIKHTLFI
  632-  672 (52.78/83.53)	IHDNLKeqnidigslSIFCIKAE..........DFMTD..NKHSNIIKPVLFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.06|      35|     313|     410|     460|       4
---------------------------------------------------------------------------
  410-  460 (42.49/60.82)	EHNLTfevPITPTktsvlEIDVDRKT.........GKYQfFDTDHclnsnnlLIAQTNSI
  719-  762 (53.57/31.42)	EKALS...DITPT.....ENDDESSTslmamkhviSKYK.NDLQH.......LIVLTSTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.59|      16|     314|     547|     566|       6
---------------------------------------------------------------------------
  518-  542 (18.28/ 9.98)	FIRMKswpLHWylivstRINSTNDI
  551-  566 (29.30/14.22)	LIREN...VHW......QIKHLSEF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10317 with Med14 domain of Kingdom Fungi
Unable to open file!