<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10310
| Description |
Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | MSSKDDFKNQLSEMIDLLQVYRPGKISKENVECLCQILGLETFIDNLSANAGTRLSIASKIIVIDIDFDNSSERSVKDAKLVLASNFDNFNYYNAENKTNILFNSLKSSQYSDLSIFTKNLKFLRLLDAYSNTSLDXDSDNNSGNGELMGKTQSGGTSPQNSLHTGRYSVSGGNTNGRISNSMNNSPADRSPFSKMRGNKQSSSFDLFRYYTNLEDYLSAFLSDFEPYLKITSNVNDIFGIYFMNKRTETVIMKLCIKEKTPSDNTPGVLQEFQYQNNKWICENPNKMIESLYLALEIIDPDLLFMEHLISSDLVLDPLPCSTYPAPTTSIDNVATSGSSTIQMTFTSTFHHYHTFNVSNENLEYLKDISKWALWFQNVLAPSFNKCVKQIKLQKAQHKMNXSGLHRLSGENRRPSLSIMKEEGIGELNMHELVKKNTPDEDVFMDDELPVAESLPYTACSDSLKLQSTQTNEKQGGKNSKEMIILSEDYVYDEYKGSVTFYDDDFSRWSEFSEESINL |
| Length | 519 |
| Position | Middle |
| Organism | Hanseniaspora osmophila |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycodaceae> Hanseniaspora.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.520 |
| Instability index | 45.45 |
| Isoelectric point | 4.96 |
| Molecular weight | 58611.93 |
| Publications | PubMed=27856586
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10310
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.37| 16| 17| 99| 115| 1
---------------------------------------------------------------------------
99- 115 (23.14/16.88) T.NILFNSLKSSqYSDLS
118- 134 (23.23/11.93) TkNLKFLRLLDA.YSNTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.51| 16| 17| 54| 70| 3
---------------------------------------------------------------------------
54- 70 (22.28/21.32) RlSIASKIIVIDIDFDN
74- 89 (26.22/19.29) R.SVKDAKLVLASNFDN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 168.18| 56| 136| 305| 372| 5
---------------------------------------------------------------------------
243- 301 (93.35/61.43) FMNKR..TETVIMKL.CIKEKTPS...DN..TPG...VLQEFQYQNNKWICEN.PNKMIEslYLAlEIIDP
305- 372 (74.83/83.91) FMEHLisSDLVLDPLpCSTYPAPTtsiDNvaTSGsstIQMTFTSTFHHYHTFNvSNENLE..YLK.DISKW
---------------------------------------------------------------------------
|