<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10307
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSSLKQSASSASMSNAVLEGSQSSNVTLAKGNSATENTILHLPLYTQLDXYEXALSKLVSGVDSFKPDLQDAHDLIKADKMLVESLSKFPEYNDINDQLLELRAKKQSIDDKNKKILLTLNDCYTKLNTLPMVEQVQFENEILIKQREFLKAKDVLEYAMKLSKFTKIPPTFDKGMIGPINFVWPGDDSLRKGMLAMADVQEREKQSHKHELSLEQQAQIQQQQEQQQEALSKEQPGVPESKEETLIFDGKHKEEPKKQEQGNAQESQEGHNNKEDENEEEEQKATSDKEQQDEDLDLELDLFNPDEF |
Length | 308 |
Position | Middle |
Organism | Hanseniaspora osmophila |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycodaceae> Hanseniaspora.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.911 |
Instability index | 56.38 |
Isoelectric point | 4.67 |
Molecular weight | 34844.42 |
Publications | PubMed=27856586
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10307
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.22| 16| 17| 200| 216| 1
---------------------------------------------------------------------------
200- 216 (22.63/16.11) VQEREKQsHKHELSLEQ
220- 235 (26.59/14.43) IQQQQEQ.QQEALSKEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.93| 15| 17| 249| 263| 4
---------------------------------------------------------------------------
249- 263 (25.14/11.91) DGKHKEEPKKQEQGN
269- 283 (23.79/10.91) EGHNNKEDENEEEEQ
---------------------------------------------------------------------------
|