<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10288
| Description |
Uncharacterized protein |
| Sequence | MSEITRINKIVDQLVSSLESIVQYSQFSYKDEDDNNNGDTNDEGDDSDHGGLGNDDYFGSTDQYGNPQSTNTKSSAFEEITTISVNDSTQSISLVHTKAMQLITGIQELLLITRSFKERWVIGQASTFLKFAENGEALVQEEKSTQESENDEMLDSFEQKSQLLSKAMDELLKK |
| Length | 174 |
| Position | Head |
| Organism | Hanseniaspora osmophila |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycodaceae> Hanseniaspora.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.729 |
| Instability index | 34.76 |
| Isoelectric point | 4.24 |
| Molecular weight | 19481.96 |
| Publications | PubMed=27856586
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10288
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.69| 14| 15| 133| 146| 1
---------------------------------------------------------------------------
133- 146 (23.09/15.80) ENGEALVQEEKSTQ
149- 162 (24.60/17.27) ENDEMLDSFEQKSQ
---------------------------------------------------------------------------
|