<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10283
| Description |
Uncharacterized protein |
| Sequence | MQKRSITLMKKIDTNIASILQQFQSIVELSAVLDKSQGTLAVEMLKIESNASTIVRLSEELLSITRNLKESWILGQLPAVADADTEGDVITTQNNNIKVNETLYDNMNQLLQLITTINPLENNDQTTTDNLQD |
| Length | 133 |
| Position | Head |
| Organism | Pachysolen tannophilus NRRL Y-2460 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Pachysolen.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.247 |
| Instability index | 43.80 |
| Isoelectric point | 4.41 |
| Molecular weight | 14846.65 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10283
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.06| 18| 22| 90| 107| 1
---------------------------------------------------------------------------
90- 107 (31.73/15.26) ITTQNNNIKVNETLYDNM
114- 131 (31.33/15.00) ITTINPLENNDQTTTDNL
---------------------------------------------------------------------------
|