<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10265
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MVTAILLVEKALPNSITSFHDLLSNELPKTSGKWSFELKIYLNNKYSKPDNFNVQQVPNKYLVTLTTSYLPNKTISMINNTKAIMTSSYLSSNDEIDHFEKGCCNSTSLDPFDFIISNKFQNLWNLKQSIRGEGGNSYEITVNNLNINDPNIIQSLPKELIEEVNNTYDTFRIRTANCSLHGSFKGFLIEIEYIDKEEAKDKTSDYNEIQQFHIKINKIKELIKQYKFPNGKLCYNVLNEDKLDYISDLVQQYSEALQF |
Length | 259 |
Position | Head |
Organism | Pachysolen tannophilus NRRL Y-2460 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Pachysolen.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.483 |
Instability index | 37.77 |
Isoelectric point | 5.49 |
Molecular weight | 29917.50 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10265
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.87| 22| 25| 141| 165| 1
---------------------------------------------------------------------------
141- 162 (37.13/24.00) TVNNLNINDPN..IIQSLPKELIE
167- 190 (33.75/14.47) TYDTFRIRTANcsLHGSFKGFLIE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.56| 12| 26| 215| 226| 2
---------------------------------------------------------------------------
215- 226 (20.32/12.50) KINKIKELIKQY
242- 253 (21.25/13.36) KLDYISDLVQQY
---------------------------------------------------------------------------
|