<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10258
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MFAFEGSEPERLRLNSVLTEGLHKTGLDSKNDDSTLSINQLIQRTIKQKGSFLNVTEDSLLKEISELESNYVDKNNDLDANVDLQESQNKEEVKVPHELKTHEEFMKQKEQIISSVHSALNESSLSLDFISLLISCVRPQAGSLSMSPHLKQHIKIGSLSSDRVQPSENQNLSQIESSKIGRGWKLESLNRSAQNLKNSSLRLRDEIEKEKNYWNGLIEVLKSNEVITTTVTKSSKEISVKYGFGDAGSNYYDKGIGLMKKNPIDGKLYFEKVNPHQSEKTNKLVNVKLYNRNGSDVPVLIGESDLFHRVQKFTAEGVTQEISKARFFLFEEELFYQLVKEAATLVSLQVTIESNKIFIDLHDEIIEIETVALEDVTPVNPELASNKRADQIDTFLRLMLCCEHKNNLDKKKFPPLALSQDQHLSSSLSTTLSLLRPIITYNKHDRTLKQVEDVLILMLTTFYNNDKAKVDEIMSKDYKLIRFCNDPNMRRLSATKLVNNNAFIRCVSSPSTLFKLFVENLKIVIRLRSLSNSSYSTINMKIYNVSETSGSAKTSNSLLNVNFTDVSQLDNCLNWAVAHYSTKIS |
| Length | 585 |
| Position | Head |
| Organism | [Candida] arabinofermentans NRRL YB-2248 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Pichiaceae> Ogataea> Ogataea/Candida clade.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.433 |
| Instability index | 44.87 |
| Isoelectric point | 6.54 |
| Molecular weight | 66361.60 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10258
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.98| 15| 20| 112| 126| 1
---------------------------------------------------------------------------
112- 126 (23.60/17.21) IISSVHSALNESSLS
133- 147 (26.38/20.21) LISCVRPQAGSLSMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.25| 29| 106| 62| 105| 2
---------------------------------------------------------------------------
69- 98 (45.72/40.54) SNYVDKNNDLDANVDLQESQNKEEVKvPHE
249- 277 (53.53/18.64) SNYYDKGIGLMKKNPIDGKLYFEKVN.PHQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.63| 15| 21| 445| 465| 5
---------------------------------------------------------------------------
440- 456 (19.22/12.10) TYNKHDRTlkQVEDVLI
461- 475 (25.41/21.15) TFYNNDKA..KVDEIMS
---------------------------------------------------------------------------
|