Description | Mediator of RNA polymerase II transcription subunit 31 (Fragment) |
Sequence | EDIPTRWEIELEFVQSLANMQYLTYLAQTGHLQDERFLNYLDYLEYWRKPNYAKQLVYPNCLHILTLLKSEQFRKDVSKTETSTILFNDMVGRWRE |
Length | 96 |
Position | Middle |
Organism | [Candida] arabinofermentans NRRL YB-2248 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Pichiaceae> Ogataea> Ogataea/Candida clade. |
Aromaticity | 0.15 |
Grand average of hydropathy | -0.573 |
Instability index | 54.97 |
Isoelectric point | 5.37 |
Molecular weight | 11710.17 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10255 No repeats found |
IDR Sequence | Start | Stop |
NA | NA | NA |
MoRF Sequence | Start | Stop |
1) ERFLNYLDYLEYWRK 2) IPTRWEIELEF 3) LFNDMVGRWRE 4) YLTYL | 35 3 86 22 | 49 13 96 26 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab