<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10251

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMSEQQDDLISSLYPPPPPYIKFFTNENINKVKELVKEGTPLSTIASTKDLRFLIPPEPPSRPTYRSFGDIWNFEDKFITLEESGIEQLYDSLPKQVEEGEEIFTQERIEELKKMTKSLLLNFLEFIGLLAKNPALSYSKIEHIRIILINLHHLLNSYRLHQSREGLILKFEEKINEDLATIDKIEKTCENIENKIKMLVSDEIQFDVNSVKNDSKHATSTTTEAAITDESNATGITEEIKEDTTMINPDEEQEEEVADESTSLDNKDIEKLRKDAIKALIAGIE
Length284
PositionMiddle
Organism[Candida] arabinofermentans NRRL YB-2248
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Pichiaceae> Ogataea> Ogataea/Candida clade.
Aromaticity0.06
Grand average of hydropathy-0.551
Instability index63.65
Isoelectric point4.65
Molecular weight32530.32
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10251
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.83|      33|      35|     199|     231|       1
---------------------------------------------------------------------------
  199-  231 (51.01/29.45)	VSDEIQFDVNSVKNDSKHATSTTTEAAITDESN
  235-  267 (51.82/30.02)	ITEEIKEDTTMINPDEEQEEEVADESTSLDNKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.03|      11|      43|      12|      22|       2
---------------------------------------------------------------------------
   12-   22 (25.98/14.10)	LYPPPPP....YIKF
   53-   67 (19.04/ 8.81)	LIPPEPPsrptYRSF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.56|      11|     161|      24|      34|       3
---------------------------------------------------------------------------
   24-   34 (20.09/13.10)	TNENI.NKVKEL
  187-  198 (17.47/10.48)	TCENIeNKIKML
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.46|      27|      46|     111|     142|       4
---------------------------------------------------------------------------
  111-  142 (41.09/36.51)	LKKMTKS.........LLLNFLEFIgllakNPAL.SYSKIEH
  150-  186 (33.37/19.25)	LHHLLNSyrlhqsregLILKFEEKI.....NEDLaTIDKIEK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10251 with Med7 domain of Kingdom Fungi
Unable to open file!