Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSTEKDISFIKSRLDSLHSIDSKIVTLLDNLSSTVENLKDGKLTGDKQNVENFRDNMSQFYNNLSFTSINLRKEVKILDNRINSQLNNSNLLPIQVNKKATWVNEDKMKQEIEEMDRVLDWDEEKLAKARKEAERFVKEPKAQTSQTKQEGDLPNQAVKVETEQATKVTDNEEFPTEIKPKLEDVELPNIEANGGDGTGTGAEAADIDLDMDMGLEDEEMMNV |
Length | 223 |
Position | Head |
Organism | [Candida] arabinofermentans NRRL YB-2248 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Pichiaceae> Ogataea> Ogataea/Candida clade. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.856 |
Instability index | 41.60 |
Isoelectric point | 4.53 |
Molecular weight | 25295.89 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10246 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 91.52| 30| 31| 161| 190| 1 --------------------------------------------------------------------------- 161- 190 (48.09/23.39) ETEQATKV.TDNEEFPTEIKPKLEDVELPNI 193- 223 (43.44/20.62) NGGDGTGTgAEAADIDLDMDMGLEDEEMMNV --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 87.49| 24| 24| 47| 70| 2 --------------------------------------------------------------------------- 29- 44 (16.69/ 6.17) .........DNLSSTVE.NLKDGKLT 47- 70 (42.28/24.71) KQ.NVENFRDNMSQFYN.NLSFTSIN 73- 97 (28.53/14.75) KEvKILDNRIN.SQLNNsNLLPIQVN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.14| 15| 16| 102| 117| 3 --------------------------------------------------------------------------- 102- 117 (24.11/20.02) WvNEDKMKQEIEEMDR 121- 135 (24.03/14.49) W.DEEKLAKARKEAER --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IKPKLEDVELPNI 2) TGAEAADIDLDMDMGLEDEEMMNV | 178 200 | 190 223 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab