<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10244
| Description |
Uncharacterized protein |
| Sequence | MFFASLAYVDQNHQALVLSPTDKKVEDPDHHPPSAYDFQESLKELTTDIILKTRQILTIIDTLPGVGVSKEEQLLKIENLTRELDELELKKKKTILKKENLVDFVNELILHVSNGIAETRD |
| Length | 121 |
| Position | Middle |
| Organism | [Candida] arabinofermentans NRRL YB-2248 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Pichiaceae> Ogataea> Ogataea/Candida clade.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.359 |
| Instability index | 26.84 |
| Isoelectric point | 5.07 |
| Molecular weight | 13823.66 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10244
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 76.64| 18| 19| 70| 87| 1
---------------------------------------------------------------------------
52- 63 (19.10/ 8.71) KTRQILTI......IDTL
70- 87 (29.24/16.15) KEEQLLKIENLTRELDEL
91- 108 (28.29/15.45) KKKTILKKENLVDFVNEL
---------------------------------------------------------------------------
|