<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10239
| Description |
CSE2-domain-containing protein |
| Sequence | MADRLTQLQTCLDQLVEQFNATVNYVNTHSEPALLDDDSRSVINMAAAAPVPGQHQEQDNSGQALAGAGAKDESLSAVTFDNTITELSTDIILKSRQISMLIDSLPGIGVSPESQMQIIEELTQELEDVENQRVAKIEEKDKLLKWVESLIAEVATGISETKR |
| Length | 163 |
| Position | Middle |
| Organism | Suhomyces tanzawaensis NRRL Y-17324 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Suhomyces.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.298 |
| Instability index | 52.95 |
| Isoelectric point | 4.29 |
| Molecular weight | 17807.70 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP10239
No repeats found
No repeats found
|