<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10237
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLHRKETPFKSVPVSRVSSSQRLNQLGSNPHPSIPTTPVHVSSSLNPIRNLPVNPGNYRSKITNRDELKRFEELPIVHQVTEFERLLGELSSSISSFKDDGLVKNVESMIHVNEDLKAKIADLQSHRELGKQIEKLNQENISLEAKSKHILKELISYRSSLKELPRRPASKKVVANDVDVSEVLKYAMKLAKFTKAPVANAQFTVHPNNYVWPAEDALRRGMLAASSLQEDAIIKNELGEEDVEMAKEVVAKEEAKEEDKAQEREEEKPGRRSSFGDYGAQEAEQPKQEESGGLDLDLFDPDDEFSD |
| Length | 307 |
| Position | Middle |
| Organism | Suhomyces tanzawaensis NRRL Y-17324 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Suhomyces.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.754 |
| Instability index | 56.67 |
| Isoelectric point | 5.47 |
| Molecular weight | 34562.38 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10237
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.49| 21| 21| 12| 32| 1
---------------------------------------------------------------------------
9- 30 (30.92/22.39) FKsVPVSRVSSSQRLNQLGSNP
31- 52 (34.56/25.92) HPsIPTTPVHVSSSLNPIRNLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.76| 26| 26| 94| 119| 2
---------------------------------------------------------------------------
71- 96 (36.67/24.05) FEEL.PIVHQVTEFERLLGELSSSISS
97- 122 (39.76/26.66) FKDD.GLVKNVESMIHVNEDLKAKIAD
123- 146 (23.32/12.77) LQSHrELGKQIEKLNQENISLEAK...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.69| 16| 28| 153| 168| 3
---------------------------------------------------------------------------
153- 168 (26.69/20.29) ELISYRSSLKELPRRP
182- 197 (26.00/19.58) EVLKYAMKLAKFTKAP
---------------------------------------------------------------------------
|