<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10233
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAEQLDEIQWKSPEFIQERGLHTGNVLEYFALSPFYDRTSNNQVLMMQFQFQQIQIPIGVSFHQYFQNRLLEMTGVEFVIAYNREPDFWIIRKQRRLDANSTLTLQDYYIIGANVYQAPKIYDALSSRLLSSVLLLKNSIDLLNNMTKYQILDGGHSYNNAQPVASTPSTSQPKPPVSATPVLHTPQTVGGSAGTVDSVSNQMSTNEGIEITSSAFNNLLNNVVQAAPSIYLDDIPLYGKGSTVEMLGLKVSSDP |
| Length | 255 |
| Position | Head |
| Organism | Suhomyces tanzawaensis NRRL Y-17324 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Suhomyces.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.227 |
| Instability index | 36.57 |
| Isoelectric point | 5.04 |
| Molecular weight | 28474.81 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP10233
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.81| 10| 16| 161| 170| 3
---------------------------------------------------------------------------
161- 170 (18.91/10.32) AQPVASTPST
179- 188 (19.91/11.17) ATPVLHTPQT
---------------------------------------------------------------------------
|