<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10224

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMETHSRIPLFKMNKLTISQLIPRILIERKSFLNITEESLKEEIANPEQESEPSSEVPDTLQEIDSPQVLEDDVLDVFQTQKAELSKNINTALNETSLSLDFVSLLLSSVKPNIAKSTISPHLSKSAPLGSLNADRLSKGEDDDKAAHDEKAKLSTKIGEGWKKESINKITTLFKNSSTTLKDQVLREKNYWNMINIVLSNDEVLFRTRDPLNGSRAIGIKYGYGDSGSNYHVQGSAILRKDNTTGEVTFNPLTSGSNRSQRKVHKYIRIKILSEIDGDYMLTGQSTFIPPTATNSGFSSDSPAQKLLEEIQKARYFLFEEDLFYQLTREAKTLINYNISIISNKIIIEINNEIIEIESVVFDESNEDELTNNYQNINEFSSMHNKKCQLILVYLKLMLCCYYKYNLALKQKIPTAFTKKKQANSHPLILRPMVGNIRYELNIQNMQQILDKLFNKYKKELDVTSELEKYSNMKADDISNPFQKSIERPVSNFKVILRNHKNDFIYKVEIELTTNEIFMNLIINMSIIRFSSSNELEKNLNGLNVLQMSFNDFNDIEECLDWSILKFVHSQ
Length570
PositionHead
OrganismSuhomyces tanzawaensis NRRL Y-17324
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Suhomyces.
Aromaticity0.08
Grand average of hydropathy-0.459
Instability index51.40
Isoelectric point5.79
Molecular weight65399.67
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP10224
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.15|      15|      29|      48|      62|       1
---------------------------------------------------------------------------
   48-   62 (25.50/14.38)	QESEPSSEVPDTLQE
   80-   94 (23.65/12.86)	QKAELSKNINTALNE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      96.99|      26|      40|     232|     259|       2
---------------------------------------------------------------------------
  197-  216 (19.08/ 8.19)	.....VLSND....EVLFrtrDPL....NG.S.RA
  232-  259 (43.72/34.36)	VQGSAILRKDntTGEVTF...NPLT...SG.SNRS
  275-  301 (34.19/20.14)	IDGDYML.....TGQSTF...IPPTatnSGfSSDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.89|      16|      17|     514|     529|       3
---------------------------------------------------------------------------
  514-  529 (29.01/17.92)	NEIFMNL....IINMSIIRF
  533-  552 (22.88/12.69)	NELEKNLnglnVLQMSFNDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.07|      29|     319|      13|      45|       4
---------------------------------------------------------------------------
   13-   45 (37.52/35.03)	NKLTISqlIPRILIERKSFlnITEESLKEEIAN
  343-  371 (47.55/30.00)	NKIIIE..INNEIIEIESV..VFDESNEDELTN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     133.90|      41|      67|     403|     443|       5
---------------------------------------------------------------------------
  403-  443 (68.82/49.03)	KYNLALKQKIPTAFTK..KKQANSHPLILRPMVGNIRYELNIQ
  468-  510 (65.08/45.95)	KYSNMKADDISNPFQKsiERPVSNFKVILRNHKNDFIYKVEIE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP10224 with Med17 domain of Kingdom Fungi

Unable to open file!