Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MASTNTDEAIESAKNILHNLTDITTELLVQVHDFQGTESSRDGLAIVMNSTVENLEKLQRSNLTALDNVQIPLDVVQYIEDGRNPDVYTREFVEATRKSNQYLRGKMVAMRQLRDVLAQKISTEFSELEPSVKDIIERTND |
Length | 141 |
Position | Middle |
Organism | Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / CCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) (Torula yeast) (Candida utilis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Cyberlindnera. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.493 |
Instability index | 42.21 |
Isoelectric point | 4.70 |
Molecular weight | 15997.72 |
Publications | PubMed=26150016 PubMed=27535936 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP10217 No repeats found |
MoRF Sequence | Start | Stop |
1) QIPLDVVQYI 2) VYTREFVE 3) YLRGKMV | 70 87 102 | 79 94 108 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab