<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10214
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MTQQTQQSTTMDTQMLSQLMKTTPIPSVLLQRIPNLPPNVNTWTQIFGLMTSGQLNQSYAPIIRQAYSVHLQMLQKQHAQKIQ |
| Length | 83 |
| Position | Tail |
| Organism | Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / CCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) (Torula yeast) (Candida utilis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Cyberlindnera.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.396 |
| Instability index | 43.11 |
| Isoelectric point | 10.17 |
| Molecular weight | 9495.94 |
| Publications | PubMed=27535936
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP10214
No repeats found
No repeats found
|