| Description | CSE2-domain-containing protein |
| Sequence | MADRLTQLQICLDQLVEQFCATLHYVDTHHEFIPAEGEEAMTDPQATVATKEEFKDTIDELSTDLILKTRQIFALIDSLPGAGVSQQEQIKKVVDLQKELESVEEEKLQAVRQKDELLAWCNDLVTSFSKELIESKKMA |
| Length | 139 |
| Position | Middle |
| Organism | Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / CCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) (Torula yeast) (Candida utilis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Phaffomycetaceae> Cyberlindnera. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.323 |
| Instability index | 45.31 |
| Isoelectric point | 4.49 |
| Molecular weight | 15794.76 |
| Publications | PubMed=26150016 PubMed=27535936 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi transcription corepressor activity GO:0003714 IEA:EnsemblFungi |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats |
>MDP10203
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.15| 15| 16| 58| 72| 1
---------------------------------------------------------------------------
58- 72 (23.74/14.46) IDELSTDLILKTRQI
76- 90 (25.41/15.86) IDSLPGAGVSQQEQI
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KEEFKDTIDELSTDLILKTRQI 2) VVDLQKELES | 51 93 | 72 102 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab