<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10203
| Description |
CSE2-domain-containing protein |
| Sequence | MADRLTQLQICLDQLVEQFCATLHYVDTHHEFIPAEGEEAMTDPQATVATKEEFKDTIDELSTDLILKTRQIFALIDSLPGAGVSQQEQIKKVVDLQKELESVEEEKLQAVRQKDELLAWCNDLVTSFSKELIESKKMA |
| Length | 139 |
| Position | Middle |
| Organism | Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / CCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) (Torula yeast) (Candida utilis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Cyberlindnera.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.323 |
| Instability index | 45.31 |
| Isoelectric point | 4.49 |
| Molecular weight | 15794.76 |
| Publications | PubMed=26150016
PubMed=27535936
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP10203
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.15| 15| 16| 58| 72| 1
---------------------------------------------------------------------------
58- 72 (23.74/14.46) IDELSTDLILKTRQI
76- 90 (25.41/15.86) IDSLPGAGVSQQEQI
---------------------------------------------------------------------------
|