<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10202
Description |
Mediator of RNA polymerase II transcription subunit 31 (Fragment) |
Sequence | EPQPAPTRWEVELEFVQALANLQYLNFLAQNKYLEKEEFLNYLKYLEYWREPQYAKHLVYPNCLHVLTLLQSAHFREQILRQDTAAVLMNDMVNRWKEPQTM |
Length | 102 |
Position | Middle |
Organism | Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / CCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) (Torula yeast) (Candida utilis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Cyberlindnera.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.527 |
Instability index | 60.06 |
Isoelectric point | 5.57 |
Molecular weight | 12401.07 |
Publications | PubMed=27535936
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10202
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.67| 19| 19| 17| 35| 1
---------------------------------------------------------------------------
13- 33 (27.76/10.38) LEfvQALANLQYLNFLAQNKY
34- 54 (31.91/12.62) LEkeEFLNYLKYLEYWREPQY
---------------------------------------------------------------------------
|