<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10201
Description |
Uncharacterized protein |
Sequence | MNQKRSETLIKKVETNTELLISRMQTIIALSASTSAQEIQASEMLQIESNASMIVRLVEELLSISRNLKESWILGQLPKSEQQQDVVTQEAQGKVDALLQKILQSKHYNEEIGLDEEFEKEEQEEDTGIKIEQEEKIPDELILPVETDSSVVKQEPPEAAPHTDEIKQEQKEKEEEKLDADEDLIMKDGLPVDTSQLVDPMDMSDGGATNVLGDYDFDNFGNMDRDDDIMMG |
Length | 232 |
Position | Head |
Organism | Cyberlindnera jadinii (strain ATCC 18201 / CBS 1600 / CCRC 20928 / JCM 3617 / NBRC 0987 / NRRL Y-1542) (Torula yeast) (Candida utilis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Phaffomycetaceae> Cyberlindnera.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.712 |
Instability index | 61.68 |
Isoelectric point | 4.17 |
Molecular weight | 26224.89 |
Publications | PubMed=27535936
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10201
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 118.98| 37| 44| 120| 158| 1
---------------------------------------------------------------------------
79- 105 (27.97/ 9.90) ..............KSEQQQDV.VTQEAQGKV.DALL....QKILQS...
106- 151 (49.85/24.49) KHYNEEigldeefeKEEQEEDTGIKIEQEEKIpDELI....LPVETDSSV
153- 197 (41.16/18.88) KQEPPEaaphtdeiKQEQKEKEEEKLDADE....DLImkdgLPVDT.SQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 30.92| 12| 42| 9| 23| 2
---------------------------------------------------------------------------
9- 23 (15.02/18.15) LIKKVEtntELL.ISR
54- 66 (15.90/ 8.99) IVRLVE...ELLsISR
---------------------------------------------------------------------------
|