Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEEMQDHGATGQGDVSDGQKAVNFYLIEEKNKYEISVPSPLDNLMALYGLESITRSLARTNPDGSKGVKLRKSYKNHIQDLPGKHQIPPTKELPASLLDPMVAQAPDMIKEIDPQLLAQALKFDKTPIKGIPGFNTADLAINDQQTLMRTDDMSENDEYGGKKSKRKKKVQANGGDVKRQHI |
Length | 183 |
Position | Head |
Organism | Hyphopichia burtonii NRRL Y-1933 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Hyphopichia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.792 |
Instability index | 41.86 |
Isoelectric point | 6.92 |
Molecular weight | 20286.82 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10192 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.15| 16| 16| 98| 113| 1 --------------------------------------------------------------------------- 98- 113 (27.62/18.53) LLDPMVAQAPDMIKEI 117- 132 (25.52/16.64) LLAQALKFDKTPIKGI --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) ARTNPDGSKGVKLRKSYKNHIQDLPGKHQIPPTKELPASLLDP 2) LAINDQQTLMRTDDMSENDEYGGKKSKRKKKVQANGGDVKRQHI | 59 140 | 101 183 |
MoRF Sequence | Start | Stop |
1) KLRKSYKNHIQDLP | 70 | 83 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab