Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEEELPTRWEIELEFVQSLGNIQYLNYLAQNDYLTNECFLNYLNYLNYWKEPRYSKYLVYPNCLHILTLLQSEEFRRSIVNPDFMNSLMNDMVKRWQSPDDIFSSGSPNTTPNNQQQSQHDQQQQKDQGLATNGIEVRVDDVDPKGSDPSPDIKMEKPETHEPEVKLDDKNSFKPPETVKIEESAVETNNGTAAEDPQSAEGGNPSDAIEIDG |
Length | 213 |
Position | Middle |
Organism | Hyphopichia burtonii NRRL Y-1933 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Hyphopichia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.953 |
Instability index | 69.11 |
Isoelectric point | 4.30 |
Molecular weight | 24451.51 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10187 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.70| 25| 27| 136| 162| 1 --------------------------------------------------------------------------- 136- 162 (40.16/28.63) EVRVDdvDPKGSDPSPDIKMEKP..ETHE 164- 190 (34.54/18.35) EVKLD..DKNSFKPPETVKIEESavETNN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 82.05| 17| 44| 36| 52| 3 --------------------------------------------------------------------------- 36- 52 (32.66/16.76) NECFLNYL..NYLNYWKEP 57- 72 (21.73/ 9.43) YLVYPNCL..HILTLLQS. 81- 99 (27.66/13.40) NPDFMNSLmnDMVKRWQSP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KPETHEPEVKLDDK 2) NPSDAIEIDG 3) PETVKIEESAVE | 157 204 176 | 170 213 187 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab