<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10187
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEEELPTRWEIELEFVQSLGNIQYLNYLAQNDYLTNECFLNYLNYLNYWKEPRYSKYLVYPNCLHILTLLQSEEFRRSIVNPDFMNSLMNDMVKRWQSPDDIFSSGSPNTTPNNQQQSQHDQQQQKDQGLATNGIEVRVDDVDPKGSDPSPDIKMEKPETHEPEVKLDDKNSFKPPETVKIEESAVETNNGTAAEDPQSAEGGNPSDAIEIDG |
| Length | 213 |
| Position | Middle |
| Organism | Hyphopichia burtonii NRRL Y-1933 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Hyphopichia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.953 |
| Instability index | 69.11 |
| Isoelectric point | 4.30 |
| Molecular weight | 24451.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP10187
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.70| 25| 27| 136| 162| 1
---------------------------------------------------------------------------
136- 162 (40.16/28.63) EVRVDdvDPKGSDPSPDIKMEKP..ETHE
164- 190 (34.54/18.35) EVKLD..DKNSFKPPETVKIEESavETNN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 82.05| 17| 44| 36| 52| 3
---------------------------------------------------------------------------
36- 52 (32.66/16.76) NECFLNYL..NYLNYWKEP
57- 72 (21.73/ 9.43) YLVYPNCL..HILTLLQS.
81- 99 (27.66/13.40) NPDFMNSLmnDMVKRWQSP
---------------------------------------------------------------------------
|