<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10184
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MQIPIDSLESIRNRLNQIHLSLRKLSDQINHHNRHPNQVKLPSYSHIQNQFQVLITQLQSVASNLDNNENVLKNTNVYPLPSFPAAQHEGLVTTLLRKKPLPEVDEWIDKAISDVESFNIDIVKDDEFAKWSSSKVQELKEEFQFYGFHLDEELHFLKTEEGKRETQEKQRLQNERDEIERRITDGGKTGLNSNQVLKFMYQGILE |
Length | 206 |
Position | Head |
Organism | Hyphopichia burtonii NRRL Y-1933 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Hyphopichia.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.787 |
Instability index | 42.76 |
Isoelectric point | 5.65 |
Molecular weight | 24102.74 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP10184
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.93| 15| 22| 159| 173| 3
---------------------------------------------------------------------------
159- 173 (24.90/12.86) TEEGKRETQEKQRLQ
184- 198 (25.03/12.95) TDGGKTGLNSNQVLK
---------------------------------------------------------------------------
|