Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MTSLDEIQWKSPEWIQQFGLHTGNVLDYFTELPFFDRTSNNQVLKMQFQFQPVPNYNLQNKLSEMVGVEFIIAFIKEPNFWIIRKQQRINPSTVIPKQDYYIIGANIYQSPKIHDILSSRLLASVLSMKNSIDLLNEISNYNIMDGGHQYNKSSSITNTNTPTSVTTTSETPVTTNNLEEISSNTFDNLLKSVVNSNNDSIYLDDLPMYGKNSTVDQLNLKLNL |
Length | 224 |
Position | Head |
Organism | Hyphopichia burtonii NRRL Y-1933 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Hyphopichia. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.392 |
Instability index | 40.39 |
Isoelectric point | 5.02 |
Molecular weight | 25655.61 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP10183 No repeats found |
MoRF Sequence | Start | Stop |
1) PKQDYYIIG 2) SIYLDDLPMY | 96 200 | 104 209 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab