<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10171

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMADMYSAHVTTGNPSKTHSPSNLRPLFFLIMTDPNLRMLASAAIQKRISPLAFLQLFHQLNAKHPVSAADYADFLRATDGDEGLRARYVLALALHSYGTCGNLLDMLRSLARSPPVTQTLVLTGLLRRFADAGLGTVYAAGDVMAALAGYLETADEAVLGVCANFLLALHAMLDERAGPFPDATARLCDAVARVSSALRTRDPHTARILTAKYAALQQSAQSSYSTQGSLKSAVPKAPTSSSANSAAKARRLLWLSPMVHQWQTAAKNFLVAFENALKIQSPFLLVTELVAAAFDGYAITRLSNRTTLATLAEQNWRLFVTKKLPLLIRELGIHGAETTIVGTLAALDPKVVKVLKKAADANDDFMNLNTDDSLLDDDEFNSFPSTSRDIRHDFVVACAQLGLMLRDVFRRLAQEKHLDVALDDDNWSASPPMDLAAEFARTLNVNAELVSFEDSMLTEFLQGIPRAPLGTQNEFVEVLLTTIGQLVKDSSLVALHRLCLGLATVPEVLDIVVALQSPRALLVPLVRVVDSWNADAEDMNFQDTYTDFGCVLLLVIFVCKRYQTSPSDDSSEGGGVSLVIGLDDGSSLTDVSDGSHTAGFTRDYLANLGAARYASLCDVPVPLSDISSDDKLNELLGGWIAALFESGAISDDLMGQTTAKECYELIPLLFQQAVSACERQIIDLEVLKSGLEYFLQPFLLVTIIGIFRLLRHAFWALASPGANDDARAQLLLSIVGILSSEDELAGESKLVHKVVLQIVGTDLAAALTEFKTAQPLLIAECSPLIERLSLDGNPHQTRSYLMEYLGQSTSVNTPIYMLGTQFHQLLGWCLTNHSLPAFDPSLVPLLADTVGYEKVLLYFLKQMDHVCASENLLVGNKNLMLVVNLAVSYVLSYSGICINKVTRESWLQFLKHGDGSGDALFTAFASLKSRLDATDSEIVALFIEKLTDAVEHAIPVN
Length957
PositionTail
OrganismBabjeviella inositovora NRRL Y-12698
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Babjeviella.
Aromaticity0.07
Grand average of hydropathy0.191
Instability index37.35
Isoelectric point5.05
Molecular weight104013.08
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP10171
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     101.04|      30|      44|     363|     394|       1
---------------------------------------------------------------------------
  363-  394 (51.08/34.48)	DDFMNLNTDDSL...LDDDEFNSFPstSRDIRHDF
  407-  439 (49.96/28.03)	DVFRRLAQEKHLdvaLDDDNWSASP..PMDLAAEF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.78|      11|      24|     564|     574|       3
---------------------------------------------------------------------------
  564-  574 (20.51/10.89)	TSPSDDSSEGG
  589-  599 (20.28/10.69)	TDVSDGSHTAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.76|      16|      24|     603|     626|       4
---------------------------------------------------------------------------
  603-  618 (27.97/30.53)	DYLANLGAARYASLCD
  630-  645 (27.79/10.32)	DKLNELLGGWIAALFE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.68|      33|     233|     206|     238|       6
---------------------------------------------------------------------------
  163-  195 (55.50/37.64)	ANFLLALHAMLDERAGPFPDATARLCDAVARVS
  206-  238 (53.19/35.74)	ARILTAKYAALQQSAQSSYSTQGSLKSAVPKAP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP10171 with Med5 domain of Kingdom Fungi
Unable to open file!