<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10163
Description |
Uncharacterized protein (Fragment) |
Sequence | MPGGNIGLTPQQQQQLLSKLKTEMKQMPIPQVLLSKVQGIPPGVKNWQQVFDLIQSKVIPQQVLPALRNLHNTHLQVLFK |
Length | 80 |
Position | Tail |
Organism | Babjeviella inositovora NRRL Y-12698 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Babjeviella.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.222 |
Instability index | 64.35 |
Isoelectric point | 10.39 |
Molecular weight | 9029.65 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP10163
No repeats found
No repeats found
|