<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10158
| Description |
Uncharacterized protein |
| Sequence | MDLSSWSSTDAANYWLSSQNRHWRFSRQQLENIRLETESETRFSRPELGDPRHLRIYFHGLIQSLGRHLSVRQQALATSEIYLARFYVRTSVQETNPYLIIATCVYVACKMEECPQHIRSVVSEAKSLWPDFITHDPTKLAECEFYLIEELDSYLIVHHPYRSLIQLSKALGASGVNVGLSSDEMQTAWSVINDSYITDLPLLYPPHVIALTAIYMSVVLRPPPVAAQAERSKTRLQKIMDWFAGCGIDLEAVVDCAQEMISLYDVWESYSEKTCRELIARVVSGRRG |
| Length | 288 |
| Position | Kinase |
| Organism | Lipomyces starkeyi NRRL Y-11557 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Lipomycetaceae> Lipomyces.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.172 |
| Instability index | 58.62 |
| Isoelectric point | 5.86 |
| Molecular weight | 32995.25 |
| Publications | PubMed=27535936
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP10158
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.03| 14| 16| 16| 30| 1
---------------------------------------------------------------------------
16- 30 (20.85/14.53) LSSQNRHwRFSRQQL
35- 48 (24.18/11.25) LETESET.RFSRPEL
---------------------------------------------------------------------------
|