<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP10157
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MSVNGGKNEQAPSNPAALAKTEAQLKRVIETFIELGVMVHDFQGTVEAKEGLVERVNMTTQQFRSLVETSADLTEAIPIDVIQYIEDGRNPDVYTREFVEVLAKQNHYLNGKMEATRQFRDILAEQIKIAYPDLELAVNNSLKRTDDKSTTE |
Length | 152 |
Position | Middle |
Organism | Nadsonia fulvescens var. elongata DSM 6958 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetales incertae sedis> Nadsonia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.470 |
Instability index | 41.43 |
Isoelectric point | 4.86 |
Molecular weight | 17100.04 |
Publications | PubMed=27535936
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP10157
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.09| 17| 20| 87| 105| 1
---------------------------------------------------------------------------
87- 105 (25.94/22.50) DGRNPdvYTREFVEVLAKQ
110- 126 (30.15/19.14) NGKME..ATRQFRDILAEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.00| 18| 18| 30| 47| 2
---------------------------------------------------------------------------
30- 47 (30.92/21.12) ETFIE.LGVMVHDFQGTVE
50- 68 (25.08/16.05) EGLVErVNMTTQQFRSLVE
---------------------------------------------------------------------------
|