Description | Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
Sequence | MSADPSELGLSSVYPAPPYFYKFFTTENRDRLETLKKEALEEETAESLETIEAIIAKNLSEDNSSDNSIQYLIPPSVPDAPAYRSFGNIWPVNDRMVTLKEMGIEKLYKLSEEEGDEEQLDIGDTDISTEGSHGASHERIHQIKYLLKSLLINFLDLVGIMSISPESFPGKVEDIRVILINMH |
Length | 183 |
Position | Middle |
Organism | Nadsonia fulvescens var. elongata DSM 6958 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetales incertae sedis> Nadsonia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.370 |
Instability index | 55.82 |
Isoelectric point | 4.47 |
Molecular weight | 20623.94 |
Publications | PubMed=27535936 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP10155 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 99.17| 29| 61| 12| 42| 1 --------------------------------------------------------------------------- 12- 42 (48.54/40.13) SVYPAPPY..FYKFFTTEnrDRLETLKKEALEE 76- 106 (50.63/34.84) SVPDAPAYrsFGNIWPVN..DRMVTLKEMGIEK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PPYFYKFFT 2) SIQYLIPP | 17 68 | 25 75 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab